The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a TrpR like protein from Eubacterium eligens ATCC 27750. To be Published
    Site MCSG
    PDB Id 3g1c Target Id APC21086
    Molecular Characteristics
    Source Eubacterium eligens
    Alias Ids TPS26867,IDF+EM6U/SB+VMV6QZ/ZHG9698U, 39485 Molecular Weight 12043.89 Da.
    Residues 104 Isoelectric Point 4.88
    Sequence mnnklktqaveqlfqailslkdldeaydffedvctineilslsqrfevakmlrehrtyldiaektgast atisrvnrslnygndgydrvferlgmlekesednk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.23657
    Matthews' coefficent 3.12 Rfactor 0.20484
    Waters 59 Solvent Content 60.58

    Ligand Information
    Metals MG (MAGNESIUM) x 3



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch