.
The Open Protein Structure Annotation Network
PDB Keyword
.

3g1j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure from the mobile metagenome of Vibrio cholerae. Integron cassette protein VCH_CASS4. To be published
    Site MCSG
    PDB Id 3g1j Target Id APC7798
    Molecular Characteristics
    Source Vibrio cholerae strain opvch_op2d
    Alias Ids TPS31421,AUS0020_1_93, 666 Molecular Weight 10934.79 Da.
    Residues 93 Isoelectric Point 5.61
    Sequence vdrdylqseygvlkagqcykvvrsfrdyrninyergdvmrflgsnfvpyesglslffdkngserqimlc vrpefqmeiahhldsyfcklddn*
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.2189
    Matthews' coefficent 2.56 Rfactor 0.1917
    Waters 219 Solvent Content 52.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch