.
The Open Protein Structure Annotation Network
PDB Keyword
.

3g5j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of N-terminal domain of putative ATP/GTP binding protein from Clostridium difficile 630. To be Published
    Site MCSG
    PDB Id 3g5j Target Id APC62643.2
    Molecular Characteristics
    Source Clostridium difficile 630
    Alias Ids TPS26914,CAJ68183.1, 3.40.250.10, 272563 Molecular Weight 15006.50 Da.
    Residues 131 Isoelectric Point 5.91
    Sequence msvikiekalkldkvifvdvrtegeyeedhilnainmplfknnehnevgtiykmqgkheaiqkgfdyvs yklkdiylqaaelalnydniviycarggmrsgsivnllsslgvnvyqleggykayrnfvley
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.76 Rfree 0.198
    Matthews' coefficent 3.51 Rfactor 0.172
    Waters 282 Solvent Content 65.00

    Ligand Information
    Ligands PGE (TRIETHYLENE) x 2;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3g5j
    1. Structure of the cytoplasmic domain of the flagellar secretion apparatus component FlhA from Helicobacter pylori
    SA Moore, Y Jia - Journal of Biological Chemistry, 2010 - ASBMB
     
    2. Selenomodification of tRNA in archaea requires a bipartite rhodanese enzyme
    D Su, TT Ojo, D Sll, MJ Hohn - FEBS letters, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch