.
The Open Protein Structure Annotation Network
PDB Keyword
.

3g64

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative Enoyl-CoA Hydratase from Streptomyces coelicolor A3(2). To be Published
    Site MCSG
    PDB Id 3g64 Target Id APC40007
    Molecular Characteristics
    Source Streptomyces coelicolor a3
    Alias Ids TPS26879,NP_630095.1, 100226 Molecular Weight 29288.79 Da.
    Residues 275 Isoelectric Point 5.63
    Sequence mspftgsaaptpewrhlrveitdgvatvtlarpdklnaltfeayadlrdllaelsrrravralvlageg rgfcsggdvdeiigatlsmdtarlldfnrmtgqvvravrecpfpviaalhgvaagagavlalaadfrva dpstrfaflftrvglsggdmgaayllprvvglghatrllmlgdtvrapeaerigliselteegradeaa rtlarrladgpalahaqtkalltaeldmplaaaveldastqallmtgedyaefhaaftekrppkwqgr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.05 Rfree 0.194
    Matthews' coefficent 2.89 Rfactor 0.154
    Waters 707 Solvent Content 57.49

    Ligand Information
    Ligands GOL (GLYCEROL) x 3;SO4 (SULFATE) x 2;EDO (1,2-ETHANEDIOL) x 1
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 3g64
    1. Functional classification of protein 3D structures from predicted local interaction sites
    R Parasuram, JS Lee, P Yin, S Somarowthu - J Bioinform Comput , 2010 - worldscinet.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch