.
The Open Protein Structure Annotation Network
PDB Keyword
.

3g74

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a functionally unknown protein from Eubacterium ventriosum ATCC 27560. To be Published
    Site MCSG
    PDB Id 3g74 Target Id APC21008.1
    Molecular Characteristics
    Source Eubacterium ventriosum atcc 27560
    Alias Ids TPS26864,S97IYXOABFXBZPD2BNPVHQ+KXPA, 411463 Molecular Weight 11085.47 Da.
    Residues 97 Isoelectric Point 8.87
    Sequence msdtlyikmdqaveitkkqvtvgdvaklqcknknitnrlksmklledttkgkkryivsimkiiemadqt fqnvdiqnigetecvvefktpkkddgpm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 2.43 Rfree 0.26347
    Matthews' coefficent 2.23 Rfactor 0.20865
    Waters 97 Solvent Content 44.88

    Ligand Information
    Ligands SO4 (SULFATE) x 17
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch