.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gaa

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the protein with unknown function from Thermoplasma acidophilum. To be Published
    Site MCSG
    PDB Id 3gaa Target Id APC86194
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS5836,CAC12561.1, PF01908, 2303 Molecular Weight 27556.61 Da.
    Residues 252 Isoelectric Point 6.00
    Sequence mpkmimvnkkasesqvmelekrnynnpvvlcgfagstptgvlaasyivetlgmhqvahlisqhippvav fvggklrhpfriyannsntvlvamcevpissahiyeisntlmnwidqvgaseivimegspangipeerp vfavaekpkldkfkkagiqpadsaiiagmgggilneclvrkitglsfitptsvdipdpgavlsiieain kaynlkiktdlleeqvkaldeqikkieeqykelqekqkepqsmyg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 2.70 Rfree 0.25556
    Matthews' coefficent 3.09 Rfactor 0.19623
    Waters 35 Solvent Content 60.15

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3gaa
    1. Phylogenetic Framework and Molecular Signatures for the Main Clades of the Phylum Actinobacteria
    B Gao, RS Gupta - Microbiology and Molecular Biology Reviews, 2012 - Am Soc Microbiol
     
    2. Structure of a Proteasome-Pba1-Pba2 Complex: Implications for Proteasome Assembly, Activation, and Biological Function
    BM Stadtmueller, E Kish-Trier, K Ferrell - Journal of Biological , 2012 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch