.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gby

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a protein with unknown function CT1051 from Chlorobium tepidum. To be Published
    Site MCSG
    PDB Id 3gby Target Id APC62547.2
    Molecular Characteristics
    Source Chlorobium tepidum tls
    Alias Ids TPS26912,AAM72284.1, 3.20.20.70, 194439 Molecular Weight 13622.80 Da.
    Residues 125 Isoelectric Point 5.86
    Sequence svtfsylaetdypvftlggstadaarrlaasgcacapvldgerylgmvhlsrllegrkgwptvkeklge elletvrsyrpgeqlfdnlisvaaakcsvvpladedgryegvvsrkrilgflaeri
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.66 Rfree 0.22632
    Matthews' coefficent 2.11 Rfactor 0.17929
    Waters 249 Solvent Content 41.70

    Ligand Information
    Ligands SO4 (SULFATE) x 2;EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3gby
    1. Functional studies on bacterial nucleotide-regulated inorganic pyrophosphatases
    J Jmsn - 2011 - doria.fi
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch