.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gdz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of arginyl-tRNA synthetase from Klebsiella pneumoniae subsp. pneumoniae. To be Published
    Site MCSG
    PDB Id 3gdz Target Id APC63109.1
    Molecular Characteristics
    Source Klebsiella pneumoniae subsp. pneumoniae mgh 78578
    Alias Ids TPS26920,ABR77814.1, 3.30.1360.70, 272620 Molecular Weight 11257.33 Da.
    Residues 106 Isoelectric Point 5.69
    Sequence mniqallsekvsqaliaagapadcepqvrqsakvqfgdyqangvmavakklgmaprqlaeqvlshldln giankveiagpgfinifldpafladnvnralqserlg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.24777
    Matthews' coefficent 2.26 Rfactor 0.19226
    Waters 191 Solvent Content 45.51

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 9
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch