.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ge2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative Lipoprotein SP_0198 from Streptococcus pneumoniae. To be Published
    Site MCSG
    PDB Id 3ge2 Target Id APC89707
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS26943,AAK74378.1, 170187 Molecular Weight 13706.22 Da.
    Residues 127 Isoelectric Point 3.97
    Sequence aqqvqqpvaqqqvqqpaqqntntanaggnqnqaapvqnqpvaqptdidgtytgqddgdritlvvtgttg twtelesdgdqkvkqvtldsanqrmiigddvkiytvngnqivvddmdrdpsdqivltk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.224
    Matthews' coefficent 3.71 Rfactor 0.189
    Waters 82 Solvent Content 66.87

    Ligand Information
    Ligands GOL (GLYCEROL) x 4
    Metals K (POTASSIUM) x 1;CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 3ge2
    1. Pneumococcal surface proteins: when the whole is greater than the sum of its parts
    I Prez_Dorado, S Galan_Bartual - Molecular Oral , 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch