.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gem

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of short-chain dehydrogenase from Pseudomonas syringae. To be Published
    Site MCSG
    PDB Id 3gem Target Id APC65077
    Molecular Characteristics
    Source Pseudomonas syringae pv. phaseolicola 1448a
    Alias Ids TPS26926,AAZ34968.1, 3.40.50.720, 264730 Molecular Weight 25495.81 Da.
    Residues 236 Isoelectric Point 6.54
    Sequence mtlssapilitgasqrvglhcalrllehghrviisyrtehasvtelrqagavalygdfscetgimafid llktqtsslravvhnasewlaetpgeeadnftrmfsvhmlapylinlhceplltasevadivhisddvt rkgsskhiaycatkaglesltlsfaarfaplvkvngiapallmfqpkddaayranalaksalgiepgae viyqslrylldstyvtgttltvnggrhvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.83 Rfree 0.182
    Matthews' coefficent 1.95 Rfactor 0.149
    Waters 716 Solvent Content 36.76

    Ligand Information
    Ligands ACT (ACETATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch