.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gfv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Characterization of a Bacillus subtilis transporter for petrobactin, an anthrax stealth siderophore. Proc.Natl.Acad.Sci.USA 106 21854-21859 2009
    Site MCSG
    PDB Id 3gfv Target Id APC92213.1
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS26952,CAB12191.1, 224308 Molecular Weight 32669.23 Da.
    Residues 297 Isoelectric Point 6.04
    Sequence gnqstsskgsdtkkeqitvkhqldkngtkvpknpkkvvvfdfgsldtldklglddivaglpkqvlpkyl skfkddkyadvgslkepdfdkvaeldpdliiisarqsesykefskiaptiylgvdtakymesfksdaet igkifdkedkvkdelanidhsiadvkktaeklnknglvimandgkisafgpksryglihdvfgvapadq nikasthgqsvsyeyisktnpdylfvidrgtaigetsstkqvvendyvknvnavknghviyldsatwyl sggglesmtqmikevkdglek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.75 Rfree 0.191
    Matthews' coefficent 2.05 Rfactor 0.164
    Waters 509 Solvent Content 40.02

    Ligand Information
    Ligands ASN (PHOSPHATE) x 1;PO4 x 1
    Metals

    Jmol

     
    Google Scholar output for 3gfv
    1. Characterization of a Bacillus subtilis transporter for petrobactin, an anthrax stealth siderophore
    AM Zawadzka, Y Kim, N Maltseva - Proceedings of the , 2009 - National Acad Sciences
     
    2. Crystal structure of periplasmic catecholate-siderophore binding protein VctP from Vibrio cholerae at 1.7 resolution
    X Liu, Q Du, Z Wang, S Liu, N Li, Y Chen, C Zhu, D Zhu - FEBS letters, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch