.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ghj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure from the mobile metagenome of Halifax Harbour Sewage Outfall: Integron Cassette Protein HFX_CASS4. To be Published
    Site MCSG
    PDB Id 3ghj Target Id APC7777
    Molecular Characteristics
    Source Lactobacillus crispatus jv v101
    Alias Ids TPS26852,AUS0238_1_120, 491076 Molecular Weight 13682.03 Da.
    Residues 120 Isoelectric Point 5.93
    Sequence vpmnikglfevavkvknlekssqfyteilgfeaglldsarrwnflwvsgragmvvlqeekenwqqqhfs frvekseieplkkaleskgvsvhgpvnlewmqavslyfadpnghaleftal
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.47 Rfree 0.183
    Matthews' coefficent 2.09 Rfactor 0.168
    Waters 68 Solvent Content 41.27

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch