.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gkx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative ArsC family related protein from Bacteroides fragilis. To be Published
    Site MCSG
    PDB Id 3gkx Target Id APC61439
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS26901,CAH09078.1, 3.40.30.10, 272559 Molecular Weight 13486.23 Da.
    Residues 117 Isoelectric Point 9.08
    Sequence mktlflqypacstcqkakkwliennieytnrlivddnptveelkawiplsglpvkkffntsgvvykelk lssklptmteeeqiallatngklvkrplvvterfvlvgfkpeeweklk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.26976
    Matthews' coefficent 1.98 Rfactor 0.20648
    Waters 142 Solvent Content 37.76

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch