.
The Open Protein Structure Annotation Network
PDB Keyword
.

3glv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the lipopolysaccharide core biosynthesis protein from Thermoplasma volcanium GSS1. To be Published
    Site MCSG
    PDB Id 3glv Target Id APC61186.1
    Molecular Characteristics
    Source Thermoplasma volcanium gss1
    Alias Ids TPS5561,BAB60381.1, 3.40.50.620, 273116 Molecular Weight 15276.05 Da.
    Residues 136 Isoelectric Point 8.80
    Sequence mirvmatgvfdilhlghihylkeskklgdelvvvvardstarnngkipifdensrlaliselkvvdrai lghegdmmktvievkpdiitlgydqkfdeaelqskinklgitvkivriskydgqlnssssvrkkime
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.99 Rfree 0.24228
    Matthews' coefficent 3.22 Rfactor 0.19454
    Waters 164 Solvent Content 61.86

    Ligand Information
    Ligands SO4 (SULFATE) x 2;AMP (ADENOSINE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch