.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gmi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the protein with unknown function from Methanocaldococcus jannaschii. To be Published
    Site MCSG
    PDB Id 3gmi Target Id APC60789
    Molecular Characteristics
    Source Methanocaldococcus jannaschii dsm 2661
    Alias Ids TPS5557,AAB98952.1, 3.40.50.620, 243232 Molecular Weight 41320.18 Da.
    Residues 355 Isoelectric Point 9.05
    Sequence mligeimdlnlknfledreeiirdakrkdeksfkdfkkiveeikerenkdkivcdfteynplhkghkya lekgkehgifisvlpgplersgrgipyflnryiraemairagadivvegppmgimgsgqymrclikmfy slgaeiiprgyipektmekvidcinkgyhiqvkpykiicietgeilgeklnidnyviasmsqmiyklnr eglkfnpkfvfvkrlegisgtkireaifsgkfediknmlpkttlsilkelydngklnelilkrfedril etaneydlyeylpsnvaeilekkrpfnnieeiknslpygfsrhfrerilsklearipnetlskyinnyp akikilavkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.91 Rfree 0.20858
    Matthews' coefficent 2.68 Rfactor 0.17388
    Waters 168 Solvent Content 54.15

    Ligand Information
    Ligands MLI (MALONATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3gmi
    1. Crystal structure of CCM3, a cerebral cavernous malformation protein critical for vascular integrity
    X Li, R Zhang, H Zhang, Y He, W Ji, W Min - Journal of Biological , 2010 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch