.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gn3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative protein-disulfide isomerase from Pseudomonas syringae to 2.5A resolution. To be Published
    Site MCSG
    PDB Id 3gn3 Target Id APC61705
    Molecular Characteristics
    Source Pseudomonas syringae pv. tomato str. dc3000
    Alias Ids TPS26903,AAO58210.1, 3.40.30.10, 223283 Molecular Weight 19650.27 Da.
    Residues 179 Isoelectric Point 5.81
    Sequence mhsdalswghgprlfevfleptcpfsvkaffklddllaqagednvtvrirlqsqpwhmfsgvivrcila aatleggkesakavmtavashreefefehhaggpnldatpndiiarierysglalaeafanpelehavk whtkyarqngihvsptfminglvqpgmssgdpvskwvsdig
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.23692
    Matthews' coefficent 4.84 Rfactor 0.20568
    Waters 93 Solvent Content 74.60

    Ligand Information
    Ligands SO4 (SULFATE) x 1;GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 3gn3
    1. The crystal structure of human alpha1-microglobulin reveals a potential haem-binding site
    M Winfried, S Arne - Biochemical Journal, 2012 - biochemj.org
     
    2. The crystal structure of human alpha {Less than} sub {Greater than} 1 {Less than}/sub {Greater than}-microglobulin reveals a potential haem-binding site
    W Meining, A Skerra - 2012 - biochemj.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch