The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a thioredoxin-related protein from Desulfitobacterium hafniense DCB. To be Published
    Site MCSG
    PDB Id 3gnj Target Id APC92103
    Molecular Characteristics
    Source Desulfitobacterium hafniense dcb
    Alias Ids TPS26949,ZP_01371852.1, 272564 Molecular Weight 12653.72 Da.
    Residues 108 Isoelectric Point 4.42
    Sequence mslekldtntfeqliydegkaclvmfsrknchvcqkvtpvleelrlnyeesfgfyyvdveeektlfqrf slkgvpqilyfkdgeykgkmagdveddeveqmiadvled
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.99 Rfree 0.26605
    Matthews' coefficent 1.84 Rfactor 0.19605
    Waters 90 Solvent Content 33.23

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch