.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gqs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the FHA domain of CT664 protein from Chlamydia trachomatis. To be Published
    Site MCSG
    PDB Id 3gqs Target Id APC7925
    Molecular Characteristics
    Source Chlamydia trachomatis d
    Alias Ids TPS26862,NP_220183.1, 272561 Molecular Weight 11258.20 Da.
    Residues 106 Isoelectric Point 5.43
    Sequence qpsrfllkvlaganigaefhldsgktyivgsdpqvadivlsdmsisrqhakiiigndnsvliedlgskn gvivegrkiehqstlsanqvvalgttlfllvdyaaps
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.24419
    Matthews' coefficent 2.24 Rfactor 0.19442
    Waters 80 Solvent Content 45.10

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3gqs
    1. Structural and functional studies on the N-terminal domain of the Shigella type III secretion protein MxiG
    MA McDowell, S Johnson, JE Deane, M Cheung - Journal of Biological , 2011 - ASBMB
     
    2. Structure of the cytoplasmic domain of Yersinia pestis YscD, an essential component of the type III secretion system
    GT Lountos, JE Tropea, DS Waugh - Acta Crystallographica Section , 2012 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch