.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gx1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a domain of lin1832 from Listeria innocua. To be Published
    Site MCSG
    PDB Id 3gx1 Target Id APC63308.2
    Molecular Characteristics
    Source Listeria innocua
    Alias Ids TPS26922,CAC97063.1, 3.40.50.510, 1642 Molecular Weight 14017.76 Da.
    Residues 127 Isoelectric Point 5.70
    Sequence qvevivmmhgrstatsmvetvqellsiesgialdmpltvevkamyeklkqtvvklnpvkgvlilsdmgs ltsfgnilteelgirtktvtmvstpvvleamrkaslgrglediyqsceqlfenkykah
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.24088
    Matthews' coefficent 4.50 Rfactor 0.21160
    Waters 22 Solvent Content 72.66

    Ligand Information
    Ligands SO4 (SULFATE) x 10
    Metals

    Jmol

     
    Google Scholar output for 3gx1
    1. Genzyme Corporation, Framingham, MA 01701, USA
    RR Wei, H Hughes, S Boucher, JJ Bird, N Guziewicz - 2010 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch