.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gyg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of yhjK (haloacid dehalogenase-like hydrolase protein) from Bacillus subtilis. To be Published
    Site MCSG
    PDB Id 3gyg Target Id APC60079
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS26887,CAB12894.1, 3.40.50.1000, 224308 Molecular Weight 33198.67 Da.
    Residues 286 Isoelectric Point 5.47
    Sequence mllskkseyktlstvehpqyivfcdfdetyfphtideqkqqdiyeledyleqkskdgeliigwvtgssi esildkmgrgkfryfphfiasdlgteityfsehnfgqqdnkwnsrinegfskekveklvkqlhenhnil lnpqtqlgksrykhnfyyqeqdeindkknllaiekiceeygvsvninrcnplagdpedsydvdfipigt gkneivtfmlekynlnteraiafgdsgndvrmlqtvgngyllknatqeaknlhnlitdseyskgitntl kkligfmrrk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.45 Rfree 0.277
    Matthews' coefficent 2.02 Rfactor 0.210
    Waters 81 Solvent Content 38.98

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch