.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gyk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a thioredoxin-like oxidoreductase from Silicibacter pomeroyi DSS-3. To be Published
    Site MCSG
    PDB Id 3gyk Target Id APC61738.2
    Molecular Characteristics
    Source Silicibacter pomeroyi dss
    Alias Ids TPS28164,AAV97494.1, 3.40.30.10, 246200 Molecular Weight 18856.17 Da.
    Residues 172 Isoelectric Point 4.69
    Sequence nrdslfndpnapvlgnpegdvtvveffdyncpycrramaevqglvdadpnvrlvyrewpilgegsdfaa raalaarqqgkyeafhwalmgmsgkanetgvlriarevgldteqlqrdmeapevtahiaqsmalaqklg fngtpsfvvedalvpgfveqsqlqdavdrarkaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.76 Rfree 0.19753
    Matthews' coefficent 2.36 Rfactor 0.16006
    Waters 752 Solvent Content 47.87

    Ligand Information
    Ligands SO4 (SULFATE) x 15;EDO (1,2-ETHANEDIOL) x 6
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch