.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h04

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the protein with unknown function from Staphylococcus aureus subsp. aureus Mu50. To be Published
    Site MCSG
    PDB Id 3h04 Target Id APC61011
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus mu50
    Alias Ids TPS26889,BAB56483.1, 3.40.50.1820, 158878 Molecular Weight 31380.01 Da.
    Residues 275 Isoelectric Point 5.24
    Sequence mteikykvitkdafalpytiikaknqptkgvivyihggglmfgkandlspqyidiltehydliqlsyrl lpevsldciiedvyasfdaiqsqysncpiftfgrssgaylslliardrdidgvidfygysrintepfkt tnsyyakiaqsinetmiaqltsptpvvqdqiaqrfliyvyargtgkwinminiadytdskyniapdelk tlppvfiahcngdydvpveesehimnhvphstfervnknehdfdrrpndeaitiyrkvvdflnaitmv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.238
    Matthews' coefficent 2.06 Rfactor 0.196
    Waters 98 Solvent Content 40.16

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3h04
    1. Protein function prediction: towards integration of similarity metrics
    S Erdin, AM Lisewski, O Lichtarge - Current opinion in structural biology, 2011 - Elsevier
     
    2. Accurate protein structure annotation through competitive diffusion of enzymatic functions over a network of local evolutionary similarities
    E Venner, AM Lisewski, S Erdin, RM Ward, SR Amin - PloS one, 2010 - dx.plos.org
     
    3. Evolutionary trace for prediction and redesign of protein functional sites.
    A Wilkins, S Erdin, R Lua, O Lichtarge - Methods in molecular biology ( , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch