The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of peptide-binding domain of Kar2 protein from Saccharomyces cerevisiae. To be Published
    Site MCSG
    PDB Id 3h0x Target Id APC89502.3
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS26941,NP_012500.1, 4932 Molecular Weight 16120.48 Da.
    Residues 149 Isoelectric Point 5.38
    Sequence dvnaltlgiettggvmtplikrntaiptkksqifstavdnqptvmikvyegeramskdnnllgkfeltg ippaprgvpqievtfaldangilkvsatdkgtgksesititndkgrltqeeidrmveeaekfasedasi kakvesrnkle
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.92 Rfree 0.230
    Matthews' coefficent 2.65 Rfactor 0.186
    Waters 120 Solvent Content 53.67

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch