.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h1n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of probable glutathione S-transferase from Bordetella bronchiseptica RB50. To be Published
    Site MCSG
    PDB Id 3h1n Target Id APC84167
    Molecular Characteristics
    Source Bordetella bronchiseptica rb50
    Alias Ids TPS26928,CAE30941.1, 257310 Molecular Weight 26871.23 Da.
    Residues 233 Isoelectric Point 6.14
    Sequence maydlwywdgipgrgefvrlaleagkipyrdrarepgedmlddmrrrrdtppfappylvadgmtiaqta nillflgvehglappdragrlwvnqlqltiadltaeahdvhhpvaaglyyedqqdvalrraadfretrm pkfmqyfeqaldrpggwltdmgrwsyadlslyhvvegllhafprrmrtlvhryprlmalharvaelpel rgylasdrrlpfgdgifrhypeldga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.83 Rfree 0.22336
    Matthews' coefficent 2.18 Rfactor 0.18391
    Waters 385 Solvent Content 43.59

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 2
    Metals CL (CHLORIDE) x 6

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch