.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h1q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ethanolamine utilization protein EutJ from Carboxydothermus hydrogenoformans. To be Published
    Site MCSG
    PDB Id 3h1q Target Id APC92245
    Molecular Characteristics
    Source Carboxydothermus hydrogenoformans z-2901
    Alias Ids TPS26954,7ZJDOKHUEQX1YBO6FVGIAXECHJ4, 246194 Molecular Weight 28603.82 Da.
    Residues 269 Isoelectric Point 5.04
    Sequence meleqklnllndlivreivnplpppykvgvdlgtadivlvvtdqegipvagalkwasvvkdglvvdyig aiqivrelkakverllgselfqaataippgtvgrnaeacghvvagaglelvtlvdepvaaaralgindg ivvdigggttgiaviekgkitatfdeptggthlslvlagsykipfeeaetikkdfsrhreimpvvrpvi ekmalivkeviknydqtlpvyvvggtayltgfseefsrflgkevqvpihpllvtplgialfg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.27835
    Matthews' coefficent 3.75 Rfactor 0.22660
    Waters 28 Solvent Content 67.22

    Ligand Information
    Ligands ATP (ADENOSINE-5'-TRIPHOSPHATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3h1q
    1. The MreB-like protein Mbl of Streptomyces coelicolor A3 (2) depends on MreB for proper localization and contributes to spore wall synthesis
    A Heichlinger, M Ammelburg - Journal of , 2011 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch