.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h36

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of an uncharacterized domain in polyribonucleotide nucleotidyltransferase from Streptococcus mutans UA159. TO BE PUBLISHED
    Site MCSG
    PDB Id 3h36 Target Id APC63929.2
    Molecular Characteristics
    Source Streptococcus mutans ua159
    Alias Ids TPS26924,AAN57931.1, 210007 Molecular Weight 10554.24 Da.
    Residues 90 Isoelectric Point 4.70
    Sequence vellqvdadlqaeivgkynadlqkavqieekkareiateavkehvtaeyeeryaeheehdrimrdvaei leqmehaevrrlitedkvrpd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.236
    Matthews' coefficent 2.17 Rfactor 0.199
    Waters 90 Solvent Content 43.44

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1
    Metals CA (CALCIUM) x 1

    Jmol

     
    Google Scholar output for 3h36
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    2. Crystal structure of Pyrococcus furiosus PF2050, a member of the DUF2666 protein family
    BG Han, KC Jeong, JW Cho, BC Jeong, HK Song - FEBS letters, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch