.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h92

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of one domain of the protein with unknown function from Methanocaldococcus jannaschii. To be Published
    Site MCSG
    PDB Id 3h92 Target Id APC87993.1
    Molecular Characteristics
    Source Methanocaldococcus jannaschii dsm 2661
    Alias Ids TPS26935,AAC37088.1, BIG_806, 243232 Molecular Weight 11166.47 Da.
    Residues 92 Isoelectric Point 5.93
    Sequence dlkyiletkleeernhleellekveedyeginydevlealklfkdnyelpkskikrkiriflikenilf lnpqkgtlkpqsylvwnaikrml
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.27783
    Matthews' coefficent 2.40 Rfactor 0.20216
    Waters 36 Solvent Content 48.78

    Ligand Information
    Ligands PG6 (1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch