.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h9p

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative triphosphoribosyl-dephospho-coA synthase from Archaeoglobus fulgidus. To be Published
    Site MCSG
    PDB Id 3h9p Target Id APC86791.1
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS26930,AAB89416.1, BIG_513.2, 224325 Molecular Weight 27882.36 Da.
    Residues 246 Isoelectric Point 5.46
    Sequence rehdfddlkfehflasaagafpaflevaekriigegvlravkesmrwhraenvhfgaflllvplisswd aggmvdiaeaarnrlrrtdfrdslsvleafrlsnarvveagelnlkdrkteeeiaqkkinlyewmkmap eenliarelvdgfkisiegakfllsfgnsgkavvelyyhllskfpdplviakmgreyaekitewaekar teeerkeldekllkdganpgtiadltassiflalaegwr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.30 Rfree 0.23876
    Matthews' coefficent 2.04 Rfactor 0.19488
    Waters 142 Solvent Content 39.77

    Ligand Information
    Ligands GOL (GLYCEROL) x 1;PG4 (TETRAETHYLENE) x 1
    Metals CL (CHLORIDE) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch