The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Choloylglycine Hydrolase from Bacteroides thetaiotaomicron VPI. To be Published
    Site MCSG
    PDB Id 3hbc Target Id APC62270.1
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi
    Alias Ids TPS26908,AAO77193.1,, 226186 Molecular Weight 35501.63 Da.
    Residues 317 Isoelectric Point 7.85
    Sequence ctravylgpdrmvvtgrtmdwkedimsniyvfprgmqraghnkektvnwtskygsviatgydigtcdgm nekglvasllflpesvyslpgdtrpamgisiwtqyvldnfatvreavdemkketfridaprmpnggpes tlhmaitdetgntavieyldgklsihegkeyqvmtnspryelqlavndywkevgglqmlpgtnrssdrf vrasfyihaipqtadakiavpsvlsvmrnvsvpfgintpekphisstrwrsvsdqknkvyyfestltpn lfwldlkkidfspkagvkklsltkgeiyagdavkdlkdsqs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.27 Rfree 0.232
    Matthews' coefficent 2.89 Rfactor 0.1910
    Waters 118 Solvent Content 57.46

    Ligand Information
    Ligands GOL (GLYCEROL) x 4;EDO (1,2-ETHANEDIOL) x 4



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch