.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hcy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the domain of putative two-component sensor histidine kinase protein from Sinorhizobium meliloti 1021. To be Published
    Site MCSG
    PDB Id 3hcy Target Id APC7735
    Molecular Characteristics
    Source Sinorhizobium meliloti 1021
    Alias Ids TPS28141,NP_437596.1, 266834 Molecular Weight 16617.77 Da.
    Residues 148 Isoelectric Point 4.78
    Sequence ieevyeatldaiqgalncdrasillfdeagtmrfvaarglsehyqravdghspwitganepepifvenv ddaefsrelkesivgegiaalgffplvtegrligkfmtyydrphrfadseigmaltiarqlgfsiqrmr aeyarrqaee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.26018
    Matthews' coefficent 2.95 Rfactor 0.20674
    Waters 12 Solvent Content 58.35

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3hcy
    1. Sensor domains of two-component regulatory systems
    J Cheung, WA Hendrickson - Current opinion in microbiology, 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch