.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hcz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a domain of possible thiol-disulfide isomerase from Cytophaga hutchinsonii ATCC 33406. To be Published
    Site MCSG
    PDB Id 3hcz Target Id APC61559.2
    Molecular Characteristics
    Source Cytophaga hutchinsonii atcc 33406
    Alias Ids TPS28158,ABG57427.1, 3.40.30.10, 269798 Molecular Weight 17274.07 Da.
    Residues 145 Isoelectric Point 9.28
    Sequence plllgkkapnlymtdttgtyrylydvqakytilffwdsqcghcqqetpklydwwlknrakgiqvyaani erkdeewlkfirskkiggwlnvrdsknhtdfkitydiyatpvlyvldknkviiakrigyenlddflvqy ekslktk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.88 Rfree 0.21915
    Matthews' coefficent 2.71 Rfactor 0.17880
    Waters 124 Solvent Content 54.55

    Ligand Information
    Ligands SO4 (SULFATE) x 5;FMT (FORMIC) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch