.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hdt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative kinase from Clostridium symbiosum ATCC 14940. To be Published
    Site MCSG
    PDB Id 3hdt Target Id APC21299
    Molecular Characteristics
    Source Clostridium symbiosum atcc 14940
    Alias Ids TPS28149,JNN16ADMJFTAOAPLAFM+1NXLRGQ, 411472 Molecular Weight 25516.97 Da.
    Residues 220 Isoelectric Point 7.68
    Sequence mqggrfmgnknliitiereygsggrivgkklaeelgihfydddilklaseksavgeqffrladekagnn llyrlgggrkidlhskpspndkltspenlfkfqsevmrelaesepcifvgraagyvldqdedierliri fvytdkvkkvqrvmevdcideerakrrikkiekerkeyykyftgsewhsmknydlpinttkltleetae likayirlkgfmd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.79 Rfree 0.27565
    Matthews' coefficent 2.38 Rfactor 0.21229
    Waters 31 Solvent Content 48.42

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2
    Metals CL (CHLORIDE) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch