.
The Open Protein Structure Annotation Network
PDB Keyword
.

3he1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of secreted protein Hcp3 from Pseudomonas aeruginosa. To be Published
    Site MCSG
    PDB Id 3he1 Target Id APC22128
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS28151,AAG03652, 2.30.110.20, 208964 Molecular Weight 19090.33 Da.
    Residues 172 Isoelectric Point 5.49
    Sequence matpaymsitgtkqglitagaftedsvgntyqeghedqvmvqgfnheviiprdpqsgqptgqrvhkpvv itkvfdkasplllaaltsgerltkveiqwyrtsaagtqehyyttvledaiivdikdymhncqdpgnahf thledvhftyrkitwthevsgtsgsddwrspvag
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.10 Rfree 0.254
    Matthews' coefficent 2.29 Rfactor 0.214
    Waters 728 Solvent Content 46.30

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 3he1
    1. A common evolutionary origin for tailed-bacteriophage functional modules and bacterial machineries
    D Veesler, C Cambillau - Microbiology and Molecular Biology , 2011 - Am Soc Microbiol
     
    2. Crystal Structure of Bacteriophage SPP1 Distal Tail Protein (gp19. 1)
    D Veesler, G Robin, J Lichire, I Auzat - Journal of Biological , 2010 - ASBMB
     
    3. Structural basis for the secretion of EvpC: a key type VI secretion system protein from Edwardsiella tarda
    C Jobichen, S Chakraborty, M Li, J Zheng, L Joseph - PloS one, 2010 - dx.plos.org
     
    4. Structural biology of type VI secretion systems
    E Cascales, C Cambillau - of the Royal , 2012 - rstb.royalsocietypublishing.org
     
    5. The biochemical properties of the Francisella pathogenicity island (FPI)-encoded proteins IglA, IglB, IglC, PdpB and DotU suggest roles in type VI secretion
    OM de Bruin, BN Duplantis, JS Ludu, RF Hare - , 2011 - Soc General Microbiol
     
    6. Crystal structure of secretory protein Hcp3 from Pseudomonas aeruginosa
    J Osipiuk, X Xu, H Cui, A Savchenko - Journal of structural and , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch