.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hf7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of a CBS-domain Pair with Bound AMP from Klebsiella pneumoniae to 2.75A. To be Published
    Site MCSG
    PDB Id 3hf7 Target Id APC63102.1
    Molecular Characteristics
    Source Klebsiella pneumoniae subsp. pneumoniae mgh 78578
    Alias Ids TPS28174,ABR78341.1, 3.20.20.70, 272620 Molecular Weight 14965.46 Da.
    Residues 130 Isoelectric Point 5.07
    Sequence kvsvndimvprneivgidinddwksivrqlthsphgrivlyrdslddaismlrvreayrlmtekkeftk eimlraadeiyfvpegtplstqlvkfqrnkkkvglvvdeygdiqglvtvedileeivgdft
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.75 Rfree 0.278
    Matthews' coefficent 3.60 Rfactor 0.222
    Waters 5 Solvent Content 65.84

    Ligand Information
    Ligands AMP (ADENOSINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3hf7
    1. The CBS Domain: A Protein Module with an Emerging Prominent Role in Regulation
    AA Baykov, HK Tuominen, R Lahti - ACS Chemical Biology, 2011 - ACS Publications
     
    2. Functional studies on bacterial nucleotide-regulated inorganic pyrophosphatases
    J Jmsn - 2011 - doria.fi
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch