.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hfi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the putative regulator from Escherichia coli CFT073. To be Published
    Site MCSG
    PDB Id 3hfi Target Id APC88534
    Molecular Characteristics
    Source Escherichia coli cft073
    Alias Ids TPS28184,NP_756138.1, PF07702.3, 199310 Molecular Weight 19635.40 Da.
    Residues 170 Isoelectric Point 5.87
    Sequence nvayplgegllsfaeslesqkihfttevitsriepanryvaeklritpgqdilylerlrsigdekamli enrinielcpgiveidfnqhnlfptieslskrkirysesryaarlignerghfldisedapvlhleqlv ffsrelpvefgnvwlkgnkyylgtvlqrrels
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.25558
    Matthews' coefficent 2.30 Rfactor 0.20058
    Waters 40 Solvent Content 46.42

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch