.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hh1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Structure of a Tetrapyrrole methylase family protein domain from Chlorobium tepidum TLS. TO BE PUBLISHED
    Site MCSG
    PDB Id 3hh1 Target Id APC62550.3
    Molecular Characteristics
    Source Chlorobium tepidum tls
    Alias Ids TPS28168,AAM72871.1, 3.40.1010.10, 194439 Molecular Weight 12072.02 Da.
    Residues 114 Isoelectric Point 5.74
    Sequence hkgtlyvvatplgnlddmtfravntlrnagaiacedtrrtsillkhfgiegkrlvsyhsfneeravrqv ielleegsdvalvtdagtpaisdpgytmasaahaaglpvvpvpga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.227
    Matthews' coefficent 1.95 Rfactor 0.181
    Waters 233 Solvent Content 36.94

    Ligand Information
    Ligands SO4 (SULFATE) x 6;EDO (1,2-ETHANEDIOL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch