.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hiu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of protein (XCC3681) from Xanthomonas campestris pv. campestris str. ATCC 33913. To be Published
    Site MCSG
    PDB Id 3hiu Target Id APC40011
    Molecular Characteristics
    Source Xanthomonas campestris pv. campestris str. atcc 33913
    Alias Ids TPS28153,NP_639027.1, 190485 Molecular Weight 18305.89 Da.
    Residues 163 Isoelectric Point 4.77
    Sequence qsrerlvkwlqdayamekeaetmmaamasriehypelkrrieqhveetqqqsagvqrclellngsipta kgmlssvlasmhaagnsmmtdevtkgvgisyafehleiasyralvvaarsageqevaqicedilqqeie maewliehqeaivvaflereqlegv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.257
    Matthews' coefficent 2.08 Rfactor 0.207
    Waters 330 Solvent Content 40.78

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 17
    Metals NA (SODIUM) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch