.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hjz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of an aldolase from Prochlorococcus marinus. To be Published
    Site MCSG
    PDB Id 3hjz Target Id APC40074
    Molecular Characteristics
    Source Prochlorococcus marinus mit 9312
    Alias Ids TPS28156,JGI0156_1_333, 74546 Molecular Weight 37287.10 Da.
    Residues 333 Isoelectric Point 5.78
    Sequence mksileqlssmtvvvadtgdldsikkfqprdattnpslilaaaknpdyvklidkaiessentlpngfse ieliketvdqvsvffgkeilkiisgrvstevdarlsfdteatvkkarklinlyknfgiekerilikiaa twegikaaeilekegikcnltllfnfcqavtcananitlispfvgrildwhkaktgktsfigaedpgvi svtqiykyfkekgfktevmgasfrnldeikelagcdlltiapkfleelkrekgvlirkldastkinnsi dykfeekdfrlsmledqmaseklsegitgfskaieeleellierlsemknhklisan
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.20255
    Matthews' coefficent 2.23 Rfactor 0.15594
    Waters 341 Solvent Content 44.88

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 6;SO4 (SULFATE) x 1;PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals NA (SODIUM) x 6;CL (CHLORIDE) x 3

    Jmol

     
    Google Scholar output for 3hjz
    1. Phage auxiliary metabolic genes and the redirection of cyanobacterial host carbon metabolism
    LR Thompson, Q Zeng, L Kelly - Proceedings of the , 2011 - National Acad Sciences
     
    2. Using Catalytic Atom Maps to Predict the Catalytic Functions Present in Enzyme Active Sites
    GR Nosrati, KN Houk - Biochemistry, 2012 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch