.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hl0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Maleylacetate reductase from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 3hl0 Target Id APC64458.1
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS28180,NP_355474.1, 3.40.50.1970, 176299 Molecular Weight 36322.66 Da.
    Residues 351 Isoelectric Point 5.61
    Sequence mqpfvymaaparivfsagssadvaeeirrlglsralvlstpqqkgdaealasrlgrlaagvfseaamht pvevtktaveayraagadcvvslgggsttglgkaialrtdaaqivipttyagsevtpilgqtengvktt mrgpeilpevviydaeltlglpvaismtsglnamahaaealyardrnpiasmmaveglramiealpvvr qaphdigaretalygawlcgtvlgavgmslhhklchtlggsldlphaethavllphtiayveeaapnll aplaalvggragaglfdfaarlgapsslaalgvgaddldpmaelatanpywcprpiektairdllqraf egarpa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.18927
    Matthews' coefficent 2.21 Rfactor 0.16327
    Waters 588 Solvent Content 44.23

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 1;EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 2
    Metals CA (CALCIUM) x 2

    Jmol

     
    Google Scholar output for 3hl0
    1. Expression, purification, crystallization and preliminary X-ray analysis of maleylacetate reductase from Burkholderia sp. strain SJ98
    A Chauhan, Z Islam, RK Jain - Section F: Structural , 2009 - scripts.iucr.org
     
    2. Hidden Relationship between Conserved Residues and Locally Conserved Phosphate-Binding Structures in NAD (P)-Binding Proteins
    CY Wu, YH Hwa, YC Chen, C Lim - The Journal of Physical , 2012 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch