.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hm2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative Precorrin-6Y C5,15-Methyltransferase Targeted Domain from Corynebacterium diphtheriae. To be Published
    Site MCSG
    PDB Id 3hm2 Target Id APC90752.3
    Molecular Characteristics
    Source Corynebacterium diphtheriae
    Alias Ids TPS28186,CAE49765.1, 3.40.50.150, 1717 Molecular Weight 18802.47 Da.
    Residues 175 Isoelectric Point 6.91
    Sequence tdgqltkqhvralaisalapkphetlwdigggsgsiaiewlrstpqttavcfeiseerrerilsnainl gvsdriavqqgaprafddvpdnpdvifigggltapgvfaaawkrlpvggrlvanavtveseqmlwalrk qfggtissfaishehtvgsfitmkpalpvhqwtvvka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.21 Rfree 0.260
    Matthews' coefficent 2.44 Rfactor 0.210
    Waters 316 Solvent Content 49.62

    Ligand Information
    Ligands ACY (ACETIC) x 3
    Metals MG (MAGNESIUM) x 2;CA (CALCIUM) x 2

    Jmol

     
    Google Scholar output for 3hm2
    1. Cloning, purification and preliminary crystallographic analysis of cobalamin methyltransferases from Rhodobacter capsulatus
    A Seyedarabi, T Hutchison, TT To, E Deery - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch