.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hnw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Basic Coiled-Coil Protein of Unknown Function from Eubacterium eligens ATCC 27750. To be Published
    Site MCSG
    PDB Id 3hnw Target Id APC21094
    Molecular Characteristics
    Source Eubacterium eligens
    Alias Ids TPS28147,HQP/FPMC7D9SXNU3AXVCS32LGDQ, 39485 Molecular Weight 15625.99 Da.
    Residues 135 Isoelectric Point 5.98
    Sequence msskntaevilggkviklggyeseeylqrvasyinnkitefnkeesyrrmsaelrtdmmylniaddyfk akkmadslsldienkdkeiydlkheliaaqikaessakeikelkseinkyqknivkletelndskk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.2443
    Matthews' coefficent 3.88 Rfactor 0.213
    Waters 179 Solvent Content 68.31

    Ligand Information
    Ligands GOL (GLYCEROL) x 4
    Metals IOD (IODIDE) x 5

    Jmol

     
    Google Scholar output for 3hnw
    1. Intrinsically disordered proteins from A to Z
    VN Uversky - The international journal of biochemistry & cell biology, 2011 - Elsevier
     
    2. Multitude of binding modes attainable by intrinsically disordered proteins: a portrait gallery of disorder-based complexes
    VN Uversky - Chem. Soc. Rev., 2011 - xlink.rsc.org
     
    3. Dimerisation and structural integrity of Heparin Binding Hemagglutinin A from Mycobacterium tuberculosis: Implications for bacterial agglutination
    C Esposito, P Carullo, E Pedone, G Graziano - FEBS letters, 2010 - Elsevier
     
    4. Mapping key interactions in the dimerization process of HBHA from Mycobacterium tuberculosis, insights into bacterial agglutination
    C Esposito, M Cantisani, G D'Auria, L Falcigno - FEBS letters, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch