.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hp7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of putative hemolysin from Streptococcus thermophilus. To be Published
    Site MCSG
    PDB Id 3hp7 Target Id APC64019
    Molecular Characteristics
    Source Streptococcus thermophilus lmg 18311
    Alias Ids TPS28178,AAV60849.1, 3.40.50.150, 264199 Molecular Weight 31873.77 Da.
    Residues 288 Isoelectric Point 5.74
    Sequence mpkervdvlaykqglfetreqakrgvmaglvvnvingerydkpgekiddgtelklkgeklryvsrgglk lekalavfnlsvedmitidigastggftdvmlqngaklvyavdvgtnqlvwklrqddrvrsmeqynfry aepvdfteglpsfasidvsfislnlilpalakilvdggqvvalvkpqfeagreqigkngivressihek vletvtafavdygfsvkgldfspiqgghgnieflahlektdspqndvptsikevvaqahkefkkneeer sfgvnpkdcprk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.53 Rfree 0.177
    Matthews' coefficent 2.71 Rfactor 0.145
    Waters 379 Solvent Content 54.55

    Ligand Information
    Ligands EOH (ETHANOL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3hp7
    1. The transcriptomes of two heritable cell types illuminate the circuit governing their differentiation
    BB Tuch, QM Mitrovich, OR Homann, AD Hernday - PLoS genetics, 2010 - dx.plos.org
     
    2. Molecular characterization of tlyA gene product, Rv1694 of Mycobacterium tuberculosis: a non-conventional hemolysin and a ribosomal RNA methyl
    A Rahman, S Srivastava, A Sneh, N Ahmed - BMC , 2010 - biomedcentral.com
     
    3. Molecular modeling and in silico characterization of Mycobacterium tuberculosis TlyA: Possible misannotation of this tubercle bacilli-hemolysin
    NE Arenas, LM Salazar, CY Soto - BMC structural , 2011 - biomedcentral.com
     
    4. Crystal structure of RlmM, the 2_ O-ribose methyltransferase for C2498 of Escherichia coli 23S rRNA
    AS Punekar, TR Shepherd, J Liljeruhm - Nucleic Acids , 2012 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch