.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hqx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein of unknown function (DUF1255,PF06865) from Acinetobacter sp. ADP1. To be Published
    Site MCSG
    PDB Id 3hqx Target Id APC86610
    Molecular Characteristics
    Source Acinetobacter sp. adp1
    Alias Ids TPS28182,CAG67306.1, BIG_171.1, 62977 Molecular Weight 12072.07 Da.
    Residues 108 Isoelectric Point 4.93
    Sequence mssaqfdhvtvikksnvyfgglcishtvqfedgtkktlgvilpteqpltfethvpermeiisgecrvki adsteselfragqsfyvpgnslfkietdevldyvchleg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.66 Rfree 0.20150
    Matthews' coefficent 1.87 Rfactor 0.16278
    Waters 102 Solvent Content 34.29

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch