.
The Open Protein Structure Annotation Network
PDB Keyword
.

3htr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of PRC-barrel Domain Protein from Rhodopseudomonas palustris. To be Published
    Site MCSG
    PDB Id 3htr Target Id APC92237
    Molecular Characteristics
    Source Rhodopseudomonas palustris cga009
    Alias Ids TPS28192,BLAHEQ7MXO/CLBMPRJWBHSG0WJ4, 258594 Molecular Weight 12872.93 Da.
    Residues 117 Isoelectric Point 4.91
    Sequence mtpetnetlkligsdkvqgtavygpdgekigsiervmiekvsgrvsyavlsfggflgigddhyplpwpa lkynvelggyqvmvtvdqlerapkygpgsewdwrgarkvddyygvalt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.06 Rfree 0.231
    Matthews' coefficent 1.86 Rfactor 0.193
    Waters 56 Solvent Content 33.71

    Ligand Information
    Ligands ACY (ACETIC) x 3
    Metals ZN (ZINC) x 4

    Jmol

     
    Google Scholar output for 3htr
    1. Crenarchaeal CdvA forms double-helical filaments containing DNA and interacts with ESCRT-III-like CdvB
    C Moriscot, S Gribaldo, JM Jault, M Krupovic, J Arnaud - PloS one, 2011 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch