.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i1j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a putative short chain dehydrogenase from Pseudomonas syringae. To be Published
    Site MCSG
    PDB Id 3i1j Target Id APC7743
    Molecular Characteristics
    Source Pseudomonas syringae pv. tomato str. dc3000
    Alias Ids TPS31420,NP_791565.1, 223283 Molecular Weight 26265.30 Da.
    Residues 246 Isoelectric Point 5.56
    Sequence mfdysahpellkgrvilvtgaargigaaaarayaahgasvvllgrteaslaevsdqiksagqpqpliia lnlenataqqyrelaarvehefgrldgllhnasiigprtpleqlpdedfmqvmhvnvnatfmltrallp llkrsedasiaftsssvgrkgranwgaygvskfateglmqtladelegvtavransinpgatrtgmraq aypdenplnnpapedimpvylylmgpdstgingqalnaq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.22414
    Matthews' coefficent 2.07 Rfactor 0.16612
    Waters 324 Solvent Content 40.71

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 9;ACT (ACETATE) x 1
    Metals CL (CHLORIDE) x 1;NA (SODIUM) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch