.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i38

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a Putative Chaperone Protein Dnaj from Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578. To be Published
    Site MCSG
    PDB Id 3i38 Target Id APC63096.1
    Molecular Characteristics
    Source Klebsiella pneumoniae subsp. pneumoniae mgh 78578
    Alias Ids TPS28172,ABR79864.1, 2.60.260.20, 272620 Molecular Weight 11510.89 Da.
    Residues 106 Isoelectric Point 9.63
    Sequence hplfdivghnleivlplapweaalgakvtvptlkesilltvppgsqagqrlrikgkglvskthtgdlfa vikivmptkpdekarelwqqlaaaeasfdprktwgka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.262
    Matthews' coefficent 2.48 Rfactor 0.217
    Waters 186 Solvent Content 50.40

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3i38
    1. Detection of Spatial Correlations in Protein Structures and Molecular Complexes
    MJ Sippl, M Wiederstein - Structure, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch