.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i6y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of an esterase from the oil-degrading bacterium Oleispira antarctica. To be Published
    Site MCSG
    PDB Id 3i6y Target Id APC40077
    Molecular Characteristics
    Source Unknown organism
    Alias Ids TPS31453,OLEI01171_1_279 Molecular Weight 30977.89 Da.
    Residues 279 Isoelectric Point 5.22
    Sequence msienlssnksfggwhkqyshvsntlncamrfaiylppqastgakvpvlywlsgltcsdenfmqkagaq rlaaelgiaivapdtsprgegvaddegydlgqgagfyvnatqapwnrhyqmydyvvnelpeliesmfpv sdkraiaghsmgghgaltialrnperyqsvsafspinnpvncpwgqkaftaylgkdtdtwreydasllm raakqyvpalvdqgeadnflaeqlkpevleaaassnnyplelrshegydhsyyfiasfiedhlrfhsnylna
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.75 Rfree 0.22898
    Matthews' coefficent 2.64 Rfactor 0.18848
    Waters 508 Solvent Content 53.40

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 6;PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 3i6y
    1. Thioesterases: A new perspective based on their primary and tertiary structures
    DC Cantu, Y Chen, PJ Reilly - Protein Science, 2010 - Wiley Online Library
     
    2. Structure and activity of the cold-active and anion-activated carboxyl esterase OLEI01171 from the oil-degrading marine bacterium Oleispira antarctica
    L Sofia, T Anatoli, P Pierre, F Robert - Biochemical , 2012 - biochemj.org
     
    3. Structure and stability of a thermostable carboxylesterase from the thermoacidophilic archaeon Sulfolobus tokodaii
    C Angkawidjaja, Y Koga, K Takano, S Kanaya - FEBS Journal, 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch