.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i7m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of N-terminal domain of Xaa-Pro dipeptidase from Lactobacillus brevis. To be Published
    Site MCSG
    PDB Id 3i7m Target Id APC64794.2
    Molecular Characteristics
    Source Lactobacillus brevis atcc 367
    Alias Ids TPS31509,ABJ64310.1, 387344 Molecular Weight 15532.95 Da.
    Residues 136 Isoelectric Point 4.94
    Sequence mtkleqiqqwtaqhhasmtylsnpktieyltgfgsdpiervlalvvfpdqdpfifapaleveviketgw qfpvigyldhenpwamiadqvkqrhvnpehvaiekgqlqvarmealaaqfsapsfdlditsfiehmr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.46 Rfree 0.198
    Matthews' coefficent 2.03 Rfactor 0.163
    Waters 193 Solvent Content 39.49

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3i7m
    1. Towards structure-based protein drug design
    C Zhang, L Lai - Biochemical Society Transactions, 2011 - www-06.all-portland.net
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch