.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i8n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A domain of a conserved functionally known protein from Vibrio parahaemolyticus RIMD 2210633. To be Published
    Site MCSG
    PDB Id 3i8n Target Id APC64273.1
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS31506,BAC61175.1, 3.20.20.70, 223926 Molecular Weight 14435.10 Da.
    Residues 127 Isoelectric Point 5.77
    Sequence qdvpvtqvmtprpvvfrvdatmtinefldkhkdtpfsrplvyseqkdniigfvhrlelfkmqqsgsgqk qlgavmrpiqvvlnntalpkvfdqmmthrlqlalvvdeygtvlglvtledifehlvge
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.15 Rfree 0.2645
    Matthews' coefficent 2.95 Rfactor 0.2190
    Waters 107 Solvent Content 58.26

    Ligand Information
    Ligands FMT (FORMIC) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch