.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i9s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure from the mobile metagenome of V.cholerae. Integron cassette protein VCH_CASS6. To be Published
    Site MCSG
    PDB Id 3i9s Target Id APC7803
    Molecular Characteristics
    Source Lactobacillus crispatus jv v101
    Alias Ids TPS31422,AUS0066_1_163, 491076 Molecular Weight 18193.00 Da.
    Residues 163 Isoelectric Point 8.79
    Sequence msveikrvdkhhcldlvgifieleryyfgdkaaseqdlanylshqvfsehsgvkviaavehdkvlgfat ytimfpapklsgqmymkdlfvsssargkgiglqlmkhlatiaithncqrldwtaestnptagkfyksig aslirekeyyrfegnglnklaksl*
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.233
    Matthews' coefficent 2.62 Rfactor 0.183
    Waters 323 Solvent Content 53.11

    Ligand Information
    Ligands SO4 (SULFATE) x 8
    Metals CL (CHLORIDE) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch